PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32703.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 353aa    MW: 39786.8 Da    PI: 6.7016
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32703.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
       KHN32703.1 14 RGLWSPEEDEKLINYITTYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding491.4e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E  l+++++  lG++ W+ Ia++++ gRt++++k++w++
       KHN32703.1  67 RGSFSPQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWNS 110
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.315961IPR017930Myb domain
SuperFamilySSF466891.95E-2911108IPR009057Homeodomain-like
SMARTSM007172.0E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001674.61E-121761No hitNo description
PROSITE profilePS5129425.41262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2565116IPR009057Homeodomain-like
SMARTSM007176.1E-1666114IPR001005SANT/Myb domain
PfamPF002492.2E-1467110IPR001005SANT/Myb domain
CDDcd001672.23E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIT TYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SPQEAALIIE LHSILGNRWA QIAKHLPGRT DNEVKNFWNS NIKKKLLSHD  120
VVPSLATFSD IHGPPNSSME SFFPLTDNPI LNSHHHLDQL FLPIIPSPIL QAFDHHHHNN  180
DIKHIDINNF NNNNANFLHF QNPMPETVPP ISNNIPSLYQ EDTWSSLGCV PIHLNPNQEN  240
QIMITKSDHT TPHLIVDKFV NPSTWQQQHS VEVEPPIVPK VCESIEDYVC SIPYSSSANS  300
HEEAVACYTP AVICPQDQTA APNQVEYIDA LIMSSLPSTT TSSSSVSFFQ ANK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014622986.10.0PREDICTED: transcription factor MYB26-like
TrEMBLA0A0B2RL620.0A0A0B2RL62_GLYSO; Transcription factor MYB86
TrEMBLK7M9650.0K7M965_SOYBN; Uncharacterized protein
STRINGGLYMA15G02955.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30143168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.24e-81myb domain protein 26
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]